.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kyy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of the N-terminal Domain of Putative ATP-dependent DNA Helicase RecG-related Protein from Nitrosomonas europaea. To be Published
    Site NESGC
    PDB Id 2kyy Target Id NeR70A
    Molecular Characteristics
    Source Nitrosomonas europaea
    Alias Ids TPS55032,16991, PF04326 Molecular Weight 15935.23 Da.
    Residues 147 Isoelectric Point 4.83
    Sequence mrsatdlldelnavdesarieakrasdmgksvmetviafanepgldggylllgvdwaindkgdtvyrpv glpdpdkvqrdlasqcasmlnvalrpemqleqvggktllvvyvpeadvthkpiykkatglpggayrrig ssdqrcvde
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kyy
    1. Assessment of protein structure refinement in CASP9
    JL MacCallum, A Prez, MJ Schnieders - Proteins: Structure, , 2011 - Wiley Online Library
     
    2. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch