.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kz5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target HR4653B. To be Published
    Site NESGC
    PDB Id 2kz5 Target Id HR4653B
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS55109,1.20.5.170, 16998, 1.10.880.10, PF00170 Molecular Weight 9045.00 Da.
    Residues 78 Isoelectric Point 10.34
    Sequence rgeagsrderralamkipfptdkivnlpvddfnellarypltesqlalvrdirrrgknkvaaqncrkrk letivqler
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kz5
    1. Small angle X_ray scattering as a complementary tool for high_throughput structural studies
    TD Grant, JR Luft, JR Wolfley, H Tsuruta, A Martel - , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch