.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kz6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of protein CV0426 from Chromobacterium violaceum. To be Published
    Site NESGC
    PDB Id 2kz6 Target Id CvT2
    Molecular Characteristics
    Source Chromobacterium violaceum
    Alias Ids TPS55073,16999 Molecular Weight 11412.35 Da.
    Residues 100 Isoelectric Point 5.06
    Sequence mllhsvqtprgeilnvseqeardvfgaseqaiadarkatilqtlrierderlracdwtqvqdvvltadq katwakyrqalrdlpetvtdlsqivwpqlpv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch