.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kzn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of Peptide methionine sulfoxide reductase msrB from Bacillus subtilis, Northeast Structural Genomics Consortium Target SR10. To be Published
    Site NESGC
    PDB Id 2kzn Target Id SR10
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9061,17008, 2.170.150.20, 5619, PF01641 Molecular Weight 16600.74 Da.
    Residues 143 Isoelectric Point 5.87
    Sequence maynkeekikslnrmqyevtqnngteppfqneywdhkeeglyvdivsgkplftskdkfdsqcgwpsftk pieeeveekldtshgmirtevrsrtadshlghvfndgpgpnglrycinsaalrfvpkhklkeegyesyl hlfnk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kzn
    1. Determination of solution structures of proteins up to 40 kDa using CS-Rosetta with sparse NMR data from deuterated samples
    OF Lange, P Rossi, NG Sgourakis - Proceedings of the , 2012 - National Acad Sciences
     
    2. Structural and biochemical analysis of mammalian methionine sulfoxide reductase B2
    FL Aachmann, GH Kwak, R Del Conte - Proteins: Structure, , 2011 - Wiley Online Library
     
    3. Order and disorder in proteins
    A Ertekin - 2011 - mss3.libraries.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch