.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kzx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target CmR116. To be Published
    Site NESGC
    PDB Id 2kzx Target Id CmR116
    Molecular Characteristics
    Source Clostridium thermocellum
    Alias Ids TPS55138,17022, PF04205 Molecular Weight 17545.66 Da.
    Residues 159 Isoelectric Point 5.10
    Sequence mlrrkilamglaviiagvfagcnqtqqntpgsgtkqykdgtyyaeaddfdesgwkdtvtievkngkivs vdwnainkdggddkdtlsrnggykmveyggaqaewheqaekveaylvekqdptdikykdndghtdaisg atikvkkffdlaqkalkdaek
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kzx
    1. ASTRO_FOLD 2.0: An enhanced framework for protein structure prediction
    A Subramani, Y Wei, CA Floudas - AIChE Journal, 2011 - Wiley Online Library
     
    2. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch