The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of Nonsense mRNA reducing factor 3A from H. Sapiens, Northeast Structural Genomics Consortium Target HR4714B. To be Published
    Site NESGC
    PDB Id 2l08 Target Id HR4714B
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS55116,PF03467,, 17033 Molecular Weight 11962.19 Da.
    Residues 101 Isoelectric Point 9.23
    Sequence ekrtalskvvirrlppgltkeqleeqlrplpahdyfeffaadlslyphlysrayinfrnpddillfrdr fdgyifldskgleypavvefapfqkiakkklr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch