.
The Open Protein Structure Annotation Network
PDB Keyword
.

2l0c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of protein STY4237 (residues 36-120) from Salmonella enterica, Northeast Structural Genomics Consortium Target SlR115. To be Published
    Site NESGC
    PDB Id 2l0c Target Id SlR115
    Molecular Characteristics
    Source Salmonella enterica
    Alias Ids TPS55158,17038, PF10694 Molecular Weight 13869.19 Da.
    Residues 123 Isoelectric Point 10.38
    Sequence mskpplffiiiialivvaasfrfvqqrrekaaneaaplqqkqvvvsnkrekpvndrrsrqqevspagts mryeasfkplngglektfrlqaqqyhaltvgdqgtlsykgtrfvgfvsrtpdne
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2l0c
    1. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch