The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The amino-terminal UBA domain of OTUD7A. To be Published
    Site NESGC
    PDB Id 2l2d Target Id HT6304A
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS55174,17132, Molecular Weight 8037.50 Da.
    Residues 73 Isoelectric Point 4.53
    Sequence saecwaallhdpmtldmdavlsdfvrstgaepglardllegknwdltaalsdyeqlrqvhtanlphvfn egrg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch