.
The Open Protein Structure Annotation Network
PDB Keyword
.

2l33

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target HR4527E. To be Published
    Site NESGC
    PDB Id 2l33 Target Id HR4527E
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS55132,3.30.160.20, PF00035, 17169 Molecular Weight 8300.17 Da.
    Residues 75 Isoelectric Point 9.30
    Sequence iltkhgknpvmelnekrrglkyelisetggshdkrfvmevevdgqkfqgagsnkkvakayaalaalekl fpdtpl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2l33
    1. RNA recognition by double-stranded RNA binding domains: a matter of shape and sequence
    G Masliah, P Barraud, FHT Allain - Cellular and Molecular Life Sciences, 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch