.
The Open Protein Structure Annotation Network
PDB Keyword
.

2l3b

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site NESGC
    PDB Id 2l3b Target Id BtR376
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron
    Alias Ids TPS55148,17176 Molecular Weight 16853.26 Da.
    Residues 147 Isoelectric Point 4.78
    Sequence mymrkiisriligcyvmaalllvgacnddvdiqqsypfsietmpvpkklkvgetaeircqlhrdgrfee tkyfiryfqpdgagtlkmsdgtvllpndlyplpgetfrlyytsastdqqtvdvyfqdsfgqlqqltfsf nndsskeee
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree
    Matthews' coefficent Rfactor
    Waters Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2l3b
    1. Solution NMR structure of BT_0084, a conjugative transposon lipoprotein from Bacteroides thetaiotamicron
    TA Ramelot, Y Yang, R Xiao, TB Acton - Proteins: Structure, , 2012 - Wiley Online Library
     
    2. Structures of KIX domain of CBP in complex with two FOXO3a transactivation domains reveal promiscuity and plasticity in coactivator recruitment
    F Wang, CB Marshall, K Yamamoto - Proceedings of the , 2012 - National Acad Sciences
     
    3. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch