.
The Open Protein Structure Annotation Network
PDB Keyword
.

2l3g

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site NESGC
    PDB Id 2l3g Target Id HR4495E
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS55136,17192, PF00307, 1.10.418.10, PF11971 Molecular Weight 15056.51 Da.
    Residues 137 Isoelectric Point 5.13
    Sequence mnsaeqtvtwlitlgvlespkktisdpegflqaslkdgvvlcrllerllpgtiekvypeprseseclsn ireflrgcgaslrlellfppsqppqhlvttillsastfdandlyqgqnfnkvlsslvtlnkvtadigl
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree
    Matthews' coefficent Rfactor
    Waters Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch