.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nmm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of human phosphohistidine phosphatase. Northeast Structural Genomics Consortium target HR1409. To be Published
    Site NESGC
    PDB Id 2nmm Target Id HR1409
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS8906,PF05005 Molecular Weight 13821.71 Da.
    Residues 125 Isoelectric Point 5.65
    Sequence mavadlalipdvdtdsdgvfkyvlirihsaprsgapaaeskeivrgykwaeyhadiydkvsgdmqkqgc dceclgggrtshqsqdkkihvygysmaygpaqhaistekikakypdyevtwandgy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.70 Rfree 0.261
    Matthews' coefficent 2.20 Rfactor 0.194
    Waters 36 Solvent Content 44.08

    Ligand Information
    Ligands SO4 (SULFATE) x 6
    Metals

    Jmol

     
    Google Scholar output for 2nmm
    1. Solution structure and catalytic mechanism of human protein histidine phosphatase 1
    W Gong, Y Li, G Cui, J Hu, H Fang, C Jin, B Xia - Biochem. J, 2009 - biochemj.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch