.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nmu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the hypothetical protein from Salmonella typhimurium LT2. Northeast Structural Genomics Consortium target StR127. To be Published
    Site NESGC
    PDB Id 2nmu Target Id StR127
    Molecular Characteristics
    Source Salmonella typhimurium
    Alias Ids TPS9168,PF03479, 3.30.1330.80 Molecular Weight 15229.53 Da.
    Residues 141 Isoelectric Point 5.91
    Sequence mtvshhnastarfyalrllpgqevfsqlhafvqqnqlraawiagctgsltdvalryagqeattsltgtf evislngtleltgehlhlavsdpygvmlgghmmpgctvrttlelvigelpaltfsrqpcaisgydelhi ssr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.216
    Matthews' coefficent 2.31 Rfactor 0.185
    Waters 76 Solvent Content 46.67

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2nmu
    1. Structure-based de novo prediction of zinc-binding sites in proteins of unknown function
    W Zhao, M Xu, Z Liang, B Ding, L Niu, H Liu - , 2011 - Oxford Univ Press
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch