.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nv4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Functional insights from structural genomics. J.Struct.Funct.Genom. 8 37-44 2007
    Site NESGC
    PDB Id 2nv4 Target Id GR27
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS8891,2.40.30.70, PF01980 Molecular Weight 15808.35 Da.
    Residues 139 Isoelectric Point 6.14
    Sequence milkpigvvkspfktqndaprqgrfsdavseiaifdeyadglhkienlrhiivlywmdkasrdklrvvp pgeteergvfttrspsrpnpiglcvveilevernrlkvrwldaldgspvidikkyspeidcvnqlegqqp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.25
    Matthews' coefficent 2.07 Rfactor 0.201
    Waters 52 Solvent Content 40.61

    Ligand Information
    Ligands ACT (ACETATE) x 1;SAM (S-ADENOSYLMETHIONINE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2nv4
    1. Functional insights from structural genomics
    F Forouhar, A Kuzin, J Seetharaman, I Lee - Journal of structural and , 2007 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch