.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nvp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Hypothetical Protein CPF_0428 from Clostridium perfringens, Northeast Structural Genomics Target CpR63. TO BE PUBLISHED
    Site NESGC
    PDB Id 2nvp Target Id CpR63
    Molecular Characteristics
    Source Clostridium perfringens
    Alias Ids TPS8800,PF06824, 1.50.10.10 Molecular Weight 49728.52 Da.
    Residues 427 Isoelectric Point 5.03
    Sequence mslstnelkeivrkigkdlsgkiedkklqelfyncfintmdttvevsegdafvitgdipamwlrdstsq vehylpfvkeypelkaiftglinrqvkcifidpyanafnkepngqkwdnditkdspwvwerkyeidslc ypvrlihkywkesgdetffnddikkafnmiidlwrveqyhreksdysfqrlncsvtdtlsheglgtpvt ytgmtwsgfrpsddaceygylipanmfavvalryiseiaekvykdeelkekadslreeidnaiekhgkv ykegfgevyayetdgmgnynfmddanvpsllsipyleykgiedevyqntrkfilsknnrfffegkaakg igsphtpdqyiwhialsmqglttnnqeeidqlikllketdagtgymhegfhvddptkftrdwfawsnsl fshfiyekvinkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.245
    Matthews' coefficent 2.33 Rfactor 0.235
    Waters 269 Solvent Content 47.32

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2nvp
    1. Analysis of a New Family of Widely Distributed Metal-independent _-Mannosidases Provides Unique Insight into the Processing of N-Linked Glycans
    KJ Gregg, WF Zandberg, JH Hehemann - Journal of Biological , 2011 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch