.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nvv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Putative Acetyl-CoA hydrolase/transferase PG1013 from Porphyromonas gingivalis, Northeast Structural Genomics Target PgR16. To be Published
    Site NESGC
    PDB Id 2nvv Target Id PgR16
    Molecular Characteristics
    Source Porphyromonas gingivalis
    Alias Ids TPS9022,PF02550, 3.40.1080.10, 3.40.810.20, 3.30.750.70, PF04223 Molecular Weight 54672.46 Da.
    Residues 498 Isoelectric Point 6.18
    Sequence malrfitaeeaaefvhhndnvgfsgftpagnpkvvpaaiakraiaahekgnpfkigmftgastgarldg vlaqadavkfrtpyqsnkdlrnlinngstsyfdlhlstlaqdlrygfygkvdvaiievadvtedgkilp ttgvgilpticrladriivelndkhpkeimgmhdlcepldpparrelpvytpsdrigkpyvqvdpakiv gvvrtsepndesdfapldpvtqaigdnvaaflvsemkagripkdflplqsgvgnvanavlgalgdnpdi pafnmyteviqdavialmkkgrikfasgcslsvsrsviqdiyanldffkdkillrpqeysnnpeivrrl gvitintaleadifgninsthvsgtrmmngiggsgdftrnsyvsifttpsvmkdgkissfvpmvahhdh sehsvkviisewgvadlrgknpreraheiidkcvhpdyrpllrqylelgvkgqtpqnldccfafhqela ksgdmrnvrwedymk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.70 Rfree 0.29
    Matthews' coefficent 2.37 Rfactor 0.287
    Waters 204 Solvent Content 48.16

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 6

    Jmol

     
    Google Scholar output for 2nvv
    1. Thioesterases: A new perspective based on their primary and tertiary structures
    DC Cantu, Y Chen, PJ Reilly - Protein Science, 2010 - Wiley Online Library
     
    2. Structural insights into cold inactivation of tryptophanase and cold adaptation of subtilisin S41
    O Almog, A Kogan, M Leeuw, GY Gdalevsky - , 2008 - Wiley Online Library
     
    3. Crystal structure of 4-hydroxybutyrate CoA-transferase from Clostridium aminobutyricum
    S Macieira, J Zhang, M Velarde, W Buckel - Biological , 2009 - degruyter.com
     
    4. Crystal structure of the complex between 4-hydroxybutyrate CoA-transferase from Clostridium aminobutyricum and CoA
    S Macieira, J Zhang, W Buckel - Archives of microbiology, 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch