.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nw7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Molecular insights into substrate recognition and catalysis by tryptophan 2,3-dioxygenase. Proc.Natl.Acad.Sci.Usa 104 473-478 2007
    Site NESGC
    PDB Id 2nw7 Target Id XcR13
    Related PDB Ids 2nw9 2nw8 1yw0 
    Molecular Characteristics
    Source Xanthomonas campestris
    Alias Ids TPS9252,PF03301 Molecular Weight 34615.60 Da.
    Residues 298 Isoelectric Point 6.16
    Sequence mpvdknlrdlepgihtdlegrltyggylrldqllsaqqplsepahhdemlfiiqhqtselwlkllahel raaivhlqrdevwqcrkvlarskqvlrqlteqwsvletltpseymgfrdvlgpssgfqslqyryiefll gnknpqmlqvfaydpagqarlrevleapslyeeflrylarfghaipqqyqardwtaahvaddtlrpvfe riyentdrywreyslcedlvdvetqfqlwrfrhmrtvmrvigfkrgtggssgvgflqqalaltffpelf dvrtsvgvdnrppqgsadagkr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.70 Rfree 0.263
    Matthews' coefficent 2.13 Rfactor 0.257
    Waters 142 Solvent Content 42.37

    Ligand Information
    Ligands HEM (PROTOPORPHYRIN) x 4
    Metals

    Jmol

     
    Google Scholar output for 2nw7
    1. Molecular insights into substrate recognition and catalysis by tryptophan 2, 3-dioxygenase
    F Forouhar, JL Anderson, CG Mowat - Proceedings of the , 2007 - National Acad Sciences
     
    2. Molecular docking and spatial coarse graining simulations as tools to investigate substrate recognition, enhancer binding and conformational transitions in
    A Macchiarulo, R Nuti, D Bellocchi, E Camaioni - et Biophysica Acta (BBA , 2007 - Elsevier
     
    3. Interactions of Metals and Radicals: A Biochemical Perspective in Tryptophan Dioxygenase
    K Dornevil - 2011 - digitalarchive.gsu.edu
     
    4. The Oxidation of L-Tryptophan in Biology by Human Heme Dioxygenases
    BSA Rafice - 2010 - lra.le.ac.uk
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch