.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nw9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Molecular insights into substrate recognition and catalysis by tryptophan 2,3-dioxygenase. Proc.Natl.Acad.Sci.Usa 104 473-478 2007
    Site NESGC
    PDB Id 2nw9 Target Id XcR13
    Related PDB Ids 2nw8 1yw0 2nw7 
    Molecular Characteristics
    Source Xanthomonas campestris
    Alias Ids TPS9254,PF03301 Molecular Weight 34615.60 Da.
    Residues 298 Isoelectric Point 6.16
    Sequence mpvdknlrdlepgihtdlegrltyggylrldqllsaqqplsepahhdemlfiiqhqtselwlkllahel raaivhlqrdevwqcrkvlarskqvlrqlteqwsvletltpseymgfrdvlgpssgfqslqyryiefll gnknpqmlqvfaydpagqarlrevleapslyeeflrylarfghaipqqyqardwtaahvaddtlrpvfe riyentdrywreyslcedlvdvetqfqlwrfrhmrtvmrvigfkrgtggssgvgflqqalaltffpelf dvrtsvgvdnrppqgsadagkr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.184
    Matthews' coefficent 2.53 Rfactor 0.166
    Waters 596 Solvent Content 51.40

    Ligand Information
    Ligands FT6 (6-FLUORO-L-TRYPTOPHAN) x 1;HEM (PROTOPORPHYRIN) x 2
    Metals MN (MANGANESE) x 2

    Jmol

     
    Google Scholar output for 2nw9
    1. Molecular insights into substrate recognition and catalysis by tryptophan 2, 3-dioxygenase
    F Forouhar, JL Anderson, CG Mowat - Proceedings of the , 2007 - National Acad Sciences
     
    2. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    3. Interactions of Metals and Radicals: A Biochemical Perspective in Tryptophan Dioxygenase
    K Dornevil - 2011 - digitalarchive.gsu.edu
     
    4. The Oxidation of L-Tryptophan in Biology by Human Heme Dioxygenases
    BSA Rafice - 2010 - lra.le.ac.uk
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch