.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nwa

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Hypothetical protein YtmB from Bacillus subtilis subsp. (subtilis str. 168), Northeast Structural Genomics target SR466. To be Published
    Site NESGC
    PDB Id 2nwa Target Id SR466
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9101,2.40.240.20, PF10763 Molecular Weight 9266.29 Da.
    Residues 80 Isoelectric Point 6.58
    Sequence mgmpvefntlivtkgkevrideniftlekdgyrvypmeipmdvrktkfgeksgtaevqklqweegrtii tykltslhsvn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.70 Rfree 0.285
    Matthews' coefficent 2.26 Rfactor 0.266
    Waters 92 Solvent Content 45.46

    Ligand Information
    Ligands SO4 (SULFATE) x 8
    Metals

    Jmol

     
    Google Scholar output for 2nwa
    1. Studies on the inference of protein binding regions across fold space based on structural similarities
    J Teyra, J Hawkins, H Zhu - : Structure, Function, and , 2011 - Wiley Online Library
     
    2. Solution Structure of LCI, A Novel Antimicrobial Peptide from Bacillus subtilis
    W Gong, J Wang, Z Chen, B Xia, G Lu - Biochemistry, 2011 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch