.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nwb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Molecular insights into substrate recognition and catalysis by tryptophan 2,3-dioxygenase. Proc.Natl.Acad.Sci.Usa 104 473-478 2007
    Site NESGC
    PDB Id 2nwb Target Id SoR52
    Related PDB Ids 1zee 
    Molecular Characteristics
    Source Shewanella oneidensis
    Alias Ids TPS9152,PF08933 Molecular Weight 44976.77 Da.
    Residues 392 Isoelectric Point 6.07
    Sequence mkpatynteafdewirsrfvelnsqleqlyyqqtdranvqevgtelkhtlesegrelvkalldegntde gfdsafdllgnvglymaacrrheiteptrettsplleasalamhigasigvtprfatahltthnrahng iykrftdlpdeklfvdyntkgilaykrasdallkiqplgishpishdllrvtkqalqdviesnqqlfnr ldtdrffycvrpyykpyrvgsvvyrganagdfaginvidltlglcfaneasysqmlvdkflymmpedqq ilrecmrrpnlmddflqakgcihqdwyqenlklfievcelhgqtaiqhhnelvtkyiaepsvsmeqqhl akvtasgpplhvllaslerlrdrraavlrddirtryydlkklkdslr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.225
    Matthews' coefficent 2.27 Rfactor 0.217
    Waters 307 Solvent Content 45.80

    Ligand Information
    Ligands HEM (PROTOPORPHYRIN) x 1
    Metals

    Jmol

     
    Google Scholar output for 2nwb
    1. Molecular insights into substrate recognition and catalysis by tryptophan 2, 3-dioxygenase
    F Forouhar, JL Anderson, CG Mowat - Proceedings of the , 2007 - National Acad Sciences
     
    2. The second enzyme in pyrrolnitrin biosynthetic pathway is related to the heme-dependent dioxygenase superfamily
    W De Laurentis, L Khim, JLR Anderson, A Adam - Biochemistry, 2007 - ACS Publications
     
    3. Protein secondary structure predict based on the path with the maximum weight
    L Luo, Z Shao - Computing and Intelligent Systems, 2009. ICIS , 2009 - ieeexplore.ieee.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch