.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nwt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR Structure of Protein Y2212_ARCFU from Archaeoglobus Fulgidus; Northeast Structural Genomics Consortium Target GR83. To be Published
    Site NESGC
    PDB Id 2nwt Target Id GR83
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS8896,PF01954, 4.10.1150.10 Molecular Weight 6980.88 Da.
    Residues 61 Isoelectric Point 5.41
    Sequence mpkiieavyengvfkplqkvdlkegervkiklelkvepidlgepvsveeikkirdgtwmss
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 2

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2nwt
    1. Comprehensive comparative-genomic analysis of type 2 toxin-antitoxin systems and related mobile stress response systems in prokaryotes
    K Makarova, Y Wolf, E Koonin - Biology direct, 2009 - biomedcentral.com
     
    2. Simultaneous prediction of protein folding and docking at high resolution
    R Das, I Andr, Y Shen, Y Wu - Proceedings of the , 2009 - National Acad Sciences
     
    3. Cradle-loop barrels and the concept of metafolds in protein classification by natural descent
    V Alva, KK Koretke, M Coles, AN Lupas - Current opinion in structural , 2008 - Elsevier
     
    4. Fuzzy oil drop model applied to individual small proteins built of 70 amino acids
    K Prymula, K Sa_apa, I Roterman - Journal of molecular modeling, 2010 - Springer
     
    5. In silico structural study of random amino acid sequence proteins not present in nature
    K Prymula, M Piwowar, M Kochanczyk - Chemistry & , 2009 - Wiley Online Library
     
    6. Influence of 1 H chemical shift assignments of the interface residues on structure determinations of homodimeric proteins
    YJ Lin, DK Kirchner, P Gntert - Journal of Magnetic Resonance, 2012 - Elsevier
     
    7. Prdiction de structures de macromolcules par apprentissage automatique
    A Marcos Alvarez - 2011 - orbi.ulg.ac.be
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch