.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o0p

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Hypothetical Protein from Caulobacter Crescentus. TO BE PUBLISHED
    Site NESGC
    PDB Id 2o0p Target Id CcR55
    Related PDB Ids 2o0q 2jqn 
    Molecular Characteristics
    Source Caulobacter crescentus
    Alias Ids TPS8790,PF06108, 15281 Molecular Weight 12443.27 Da.
    Residues 114 Isoelectric Point 4.72
    Sequence mtliykilsraewdaakaqgrfegsavdladgfihlsageqaqetaakwfrgqanlvllaveaeplged lkweasrggarfphlyrpllvsevtreadldldadgvpqlgdhla
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.245
    Matthews' coefficent 3.70 Rfactor 0.234
    Waters 103 Solvent Content 66.73

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch