.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o0q

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Hypothetical Protein from Caulobacter Crescentus. TO BE PUBLISHED
    Site NESGC
    PDB Id 2o0q Target Id CcR55
    Related PDB Ids 2jqn 2o0p 
    Molecular Characteristics
    Source Caulobacter crescentus
    Alias Ids TPS8791,PF06108, 15281 Molecular Weight 12443.27 Da.
    Residues 114 Isoelectric Point 4.72
    Sequence mtliykilsraewdaakaqgrfegsavdladgfihlsageqaqetaakwfrgqanlvllaveaeplged lkweasrggarfphlyrpllvsevtreadldldadgvpqlgdhla
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.252
    Matthews' coefficent 4.07 Rfactor 0.222
    Waters 152 Solvent Content 69.79

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2o0q
    1. Iterative optimization of molecular mechanics force fields from NMR data of full-length proteins
    DW Li, R Bru_schweiler - Journal of Chemical Theory and , 2011 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch