.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o14

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-Ray structure of the hypothetical protein YXIM_BACsu from Bacillus subtilis. To be Published
    Site NESGC
    PDB Id 2o14 Target Id SR595
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9114,2.60.120.360, 3.40.50.1110, PF00657 Molecular Weight 40050.00 Da.
    Residues 367 Isoelectric Point 6.03
    Sequence mfggienvkaaepkvyqfdfgsgsmepgyigvrasdrydrskgygfqtpenmrdvaasgagvksdavef laygtksnntfnvdlpnglyevkvtlgntarasvaaegvfqvinmtgdgaedtfqipvtdgqlnllvte gkagtaftlsalkikklsdqpvtnrtiyvggdstvcnyyplnsskqagwgqmlphyidkhtfqvrnmas ggqiargfrndgqleailkyikpgdyfmlqlgindtnpkhkeseaefkevmrdmirqvkakgadvilst pqgratdftsegihssvnrwyrasilalaeeektylidlnvlssayftsigpertlglymdgdtlhpnr agadalarlavqelkrqgiagf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.205
    Matthews' coefficent 2.79 Rfactor 0.189
    Waters 268 Solvent Content 55.85

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals MN (MANGANESE) x 1

    Jmol

     
    Google Scholar output for 2o14
    1. Characterization of a new rhamnogalacturonan acetyl esterase from Bacillus halodurans C-125 with a new putative carbohydrate binding domain
    J Navarro-Fernndez, I Martnez-Martnez - Journal of , 2008 - Am Soc Microbiol
     
    2. YesT: A new rhamnogalacturonan acetyl esterase from Bacillus subtilis
    I Martnez_Martnez - Proteins: Structure, , 2008 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch