.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o18

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Thiamine biosynthesis lipoprotein apbE. To be Published
    Site NESGC
    PDB Id 2o18 Target Id ER559
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8859,PF02424 Molecular Weight 36536.52 Da.
    Residues 332 Isoelectric Point 5.46
    Sequence mdqkpqpakthatevtvlegktmgtfwrasipgidakrsaelkekiqtqldaddqllstykkdsalmrf ndsqslspwpvseamadivttslrigaktdgamditvgplvnlwgfgpeqqpvqipsqeqidamkaktg lqhltvinqshqqylqkdlpdlyvdlstvgegyaadhlarlmeqegisrylvsvggalnsrgmngeglp wrvaiqkptdkenavqavvdinghgistsgsyrnyyeldgkrlshvidpqtgrpiehnlvsvtviapta leadawdtglmvlgpekakevvrreglavymitkegdsfktwmspqfksflvsekn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.284
    Matthews' coefficent 2.08 Rfactor 0.233
    Waters 203 Solvent Content 40.76

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 4

    Jmol

     
    Google Scholar output for 2o18
    1. FAD Binding by ApbE Protein from Salmonella enterica: a New Class of FAD-Binding Proteins
    JM Boyd, JA Endrizzi, TL Hamilton - Journal of , 2011 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch