.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o1e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Metal-dependent Lipoprotein YcdH from Bacillus subtilis, Northeast Structural Genomics Target SR583. To be Published
    Site NESGC
    PDB Id 2o1e Target Id SR583
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9112,3.40.50.1980, PF01297 Molecular Weight 33488.87 Da.
    Residues 299 Isoelectric Point 5.16
    Sequence mgnsstkgsadskgdklhvvttfypmyeftkqivkdkgdvdllipssvephdweptpkdianiqdadlf vynseymetwvpsaeksmgqghavfvnaskgidlmegseeeheehdhgehehshamdphvwlspvlaqk evknitaqivkqdpdnkeyyeknskeyiaklqdldklyrttakkaekkefitqhtafgylakeyglkqv piaglspdqepsaaslaklktyakehnvkviyfeeiasskvadtlaseigaktevlntleglskeeqdk glgyidimkqnldalkdsllvks
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.60 Rfree 0.29
    Matthews' coefficent 2.05 Rfactor 0.223
    Waters 35 Solvent Content 40.10

    Ligand Information
    Ligands
    Metals MN (MANGANESE) x 2

    Jmol

     
    Google Scholar output for 2o1e
    1. The laminin-binding protein Lbp from Streptococcus pyogenes is a zinc receptor
    C Linke, TT Caradoc-Davies, PG Young - Journal of , 2009 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch