.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o1m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the probable amino-acid ABC transporter extracellular-binding protein ytmK from Bacillus subtilis. Northeast Structural Genomics Consortium target SR572. To be Published
    Site NESGC
    PDB Id 2o1m Target Id SR572
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9109,PF00497, 3.40.190.10, PF09084 Molecular Weight 28098.43 Da.
    Residues 250 Isoelectric Point 8.40
    Sequence mgagsqttgagqkkvqtitvgtgtqfpnicfidekgdltgydvelikeldkrlphykftfktmefsnll vslgqhkvdivahqmekskerekkflfnkvaynhfplkitvlqnndtirgiedlkgkrvitsatsngal vlkkwnedngrpfeiayegqganetanqlksgradatistpfavdfqnktstikektvgnvlsnakvyf mfnkneqtlsddidkalqeiiddgtlkrlslkwlgddyskeqy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.264
    Matthews' coefficent 2.37 Rfactor 0.23
    Waters 301 Solvent Content 47.99

    Ligand Information
    Ligands SO4 (SULFATE) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch