The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the hypothetical protein Q7NTB2_CHRVO from Chromobacterium violaceum. To be Published
    Site NESGC
    PDB Id 2o3i Target Id CvR68
    Molecular Characteristics
    Source Chromobacterium violaceum
    Alias Ids TPS8811,PF06032, 3.40.1610.10, 2.40.390.10 Molecular Weight 41546.03 Da.
    Residues 397 Isoelectric Point 4.91
    Sequence mafelspsdlepllqgacffgsggggtmisarhlaanfrkgdyyptdkvrvvdvdeatdgdcvmvaymg apdainqvqwpngpveaalaarqrlesqgrklayvvapesgalgfvvaslvaaklglavvdadgagrav pslpmltyaaagvpptpaflagesglcvelgvrmpppdgqrredistvveqmlrpiltnpqfgqfggla mwmmspaqlggalpvrgtlsralklgralqdgkvktaeamldflrreldikgkllfgpatlassevsta ggfdlgkvvledgerrctvlyqnesllawdsalshplatapdaisyfvegegqhvfsngdlsgndhgld psvrgrkaavialpaaaplseglilqsfadelaqlgylgpyapvdagregar
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.228
    Matthews' coefficent 2.19 Rfactor 0.198
    Waters 227 Solvent Content 43.77

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch