.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o5a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Q9KD89 from Bacillus halodurans. Northeast Structural Genomics target BhR21. To be Published
    Site NESGC
    PDB Id 2o5a Target Id BhR21
    Molecular Characteristics
    Source Bacillus halodurans
    Alias Ids TPS8762,PF02410, 3.30.460.10 Molecular Weight 13200.47 Da.
    Residues 117 Isoelectric Point 5.00
    Sequence msnqellqlavnavddkkaeqvvalnmkgisliadfflichgnsekqvqaiahelkkvaqeqgieikrl egyeqarwvlidlgdvvvhvfhkderayynleklwgdaptvelegvis
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.2783
    Matthews' coefficent 1.99 Rfactor 0.2511
    Waters 39 Solvent Content 38.11

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals MN (MANGANESE) x 4

    Jmol

     
    Google Scholar output for 2o5a
    1. C7orf30 is necessary for biogenesis of the large subunit of the mitochondrial ribosome
    J Rorbach, PA Gammage, M Minczuk - Nucleic Acids Research, 2012 - Oxford Univ Press
     
    2. C7orf30 specifically associates with the large subunit of the mitochondrial ribosome and is involved in translation
    BFJ Wanschers, R Szklarczyk, A Pajak - Nucleic Acids , 2012 - Oxford Univ Press
     
    3. RsfA (YbeB) Proteins Are Conserved Ribosomal Silencing Factors
    R Huser, M Pech, J Kijek, H Yamamoto, B Titz - PLoS Genetics, 2012 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch