.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o6k

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of UPF0346 from Staphylococcus aureus. Northeast Structural Genomics target ZR218. To be Published
    Site NESGC
    PDB Id 2o6k Target Id ZR218
    Molecular Characteristics
    Source Staphylococcus aureus
    Alias Ids TPS9271,PF06855, 1.10.150.260 Molecular Weight 8869.38 Da.
    Residues 73 Isoelectric Point 4.36
    Sequence mknysfyqfvmtvrgrhddkgrlaeeifddlafpkhdddfnilsdyiethgdftlpmsvfddlyeeyte wlkf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.217
    Matthews' coefficent 2.18 Rfactor 0.208
    Waters 82 Solvent Content 43.47

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2o6k
    1. Molecular replacement using ab initio polyalanine models generated with ROSETTA
    DJ Rigden, RM Keegan, MD Winn - Acta Crystallographica Section D , 2008 - scripts.iucr.org
     
    2. Three structural representatives of the PF06855 protein domain family from Staphyloccocus aureus and Bacillus subtilis have SAM domain-like folds and different
    GVT Swapna, P Rossi, AF Montelione - Journal of structural and , 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch