The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Hypothetical Protein AGR_C_984 from Agrobacterium tumefaciens, Northeast Structural Genomics Target AtR120. To be Published
    Site NESGC
    PDB Id 2o8s Target Id AtR120
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS8728,1.10.3700.10, PF06748 Molecular Weight 33716.12 Da.
    Residues 312 Isoelectric Point 5.87
    Sequence mapclenvacvnlsamppappspqpvshkqaatlcrqgrtcalksgsnesggsvtstytsyrlisqdig kslervskqpdvareteyyrekigsvksiddfmadtrlynyalkahgledmayakafirkvltegasdk nafanklsdnryaelaksldfaglgaaatateaaksgvignyarqtleqeagddnngvrlalyferkap tiksgldfladdalaqvfrttfnlpdafaaadvdkqaalieksinikdlqdpekvgkllerftimwemq npsttydplavfgsssgygispdllisinslklggk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.2793
    Matthews' coefficent 2.13 Rfactor 0.2429
    Waters 48 Solvent Content 42.13

    Ligand Information
    Ligands SO4 (SULFATE) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch