The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target SiR5. To be Published
    Site NESGC
    PDB Id 2oa4 Target Id SiR5
    Molecular Characteristics
    Source Silicibacter pomeroyi
    Alias Ids TPS9139,, PF06627 Molecular Weight 10401.61 Da.
    Residues 93 Isoelectric Point 9.99
    Sequence mmflrkvegprsvtlpdgsimtradlppantrrwvasrkiavvrgviyglitlaeakqiyglsdeefns wvsalaehgkdalkvtalkkyrql
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch