.
The Open Protein Structure Annotation Network
PDB Keyword
.

2obk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-Ray structure of the putative Se binding protein from Pseudomonas fluorescens. To be Published
    Site NESGC
    PDB Id 2obk Target Id PlR6
    Molecular Characteristics
    Source Pseudomonas fluorescens
    Alias Ids TPS9028,PF10262, 3.40.30.10 Molecular Weight 10818.70 Da.
    Residues 95 Isoelectric Point 5.34
    Sequence mterkpeviityctqcqwllraawlaqellstfsddlgkvslepatggafritcdgvqiwerkadggfp eakvlkqrvrdqidperdlghndrtq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.292
    Matthews' coefficent 2.37 Rfactor 0.215
    Waters 132 Solvent Content 48.01

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2obk
    1. Defining and searching for structural motifs using DeepView/Swiss-PdbViewer
    MU Johansson, V Zoete, O Michielin - BMC , 2012 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch