.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oka

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Q9HYQ7_PSEAE from Pseudomonas aeruginosa. To be Published
    Site NESGC
    PDB Id 2oka Target Id PaR82
    Molecular Characteristics
    Source Pseudomonas aeruginosa
    Alias Ids TPS9004,PF10262, 3.40.30.10 Molecular Weight 10811.81 Da.
    Residues 96 Isoelectric Point 7.66
    Sequence mptakpeivityctqcqwllraawlaqellstfaddlgkvclepgtggvfritcdgvqvwerkadggfp eakalkqrvrdridpqrdlghndrpsr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.50 Rfree 0.252
    Matthews' coefficent 2.14 Rfactor 0.217
    Waters 104 Solvent Content 42.61

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2oka
    1. Molecular replacement: the probabilistic approach of the program REMO09 and its applications
    R Caliandro, B Carrozzini, GL Cascarano - A: Foundations of , 2009 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch