.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oq0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the First HIN-200 Domain of Interferon-Inducible Protein 16. To be Published
    Site NESGC
    PDB Id 2oq0 Target Id HR4626B
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS8921,2.40.50.140, PF02760 Molecular Weight 23374.08 Da.
    Residues 202 Isoelectric Point 9.39
    Sequence qvtprrnvlqkrpvivkvlsttkpfeyetpemekkimfhatvatqtqffhvkvlntslkekfngkkiii isdyleydsllevneestvseagpnqtfevpnkiinraketlkidilhkqasgnivygvfmlhkktvnq kttiyeiqddrgkmdvvgtgqchnipceegdklqlfcfrlrkknqmsklisemhsfiqikkktn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.26
    Matthews' coefficent 2.22 Rfactor 0.208
    Waters 159 Solvent Content 44.60

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 2oq0
    1. RPA nucleic acid-binding properties of IFI16-HIN200
    H Yan, K Dalal, BK Hon, P Youkharibache - et Biophysica Acta (BBA , 2008 - Elsevier
     
    2. The PYHIN protein family as mediators of host defenses
    SA Schattgen, KA Fitzgerald - Immunological reviews, 2011 - Wiley Online Library
     
    3. Interferon-inducible protein 16: insight into the interaction with tumor suppressor p53
    JCC Liao, R Lam, V Brazda, S Duan, M Ravichandran - Structure, 2011 - Elsevier
     
    4. Crystallographic characterization of mouse AIM2 HIN-200 domain bound to a 15 bp and an 18 bp double-stranded DNA
    MW Sung, T Watts, P Li - Acta Crystallographica Section F: Structural , 2012 - scripts.iucr.org
     
    5. The interferon-inducible protein 16 is a single-stranded nucleic acid binding protein with unwinding and endonuclease activities
    B Hon - 2010 - summit.sfu.ca
     
    6. Design of alpha-conotoxin ligands: Applications in neuronal nicotinic acetylcholine receptor localization and subtype specificity
    VA Vishwanath - 2007 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch