.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ota

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the UPF0352 protein CPS_2611 from Colwellia psychrerythraea. NESG target CsR4. To be Published
    Site NESGC
    PDB Id 2ota Target Id CsR4
    Related PDB Ids 2jr2 
    Molecular Characteristics
    Source Colwellia psychrerythraea
    Alias Ids TPS8801,1.10.3390.10, PF07208, 15317 Molecular Weight 7525.45 Da.
    Residues 68 Isoelectric Point 5.21
    Sequence mpivskysnervekiiqdlldvlvkeevtpdlalmclgnavtniiaqvpeskrvavvdnftkalkqsv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.261
    Matthews' coefficent 1.89 Rfactor 0.235
    Waters 92 Solvent Content 34.95

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ota
    1. Structural classification of proteins and structural genomics: new insights into protein folding and evolution
    A Andreeva, AG Murzin - Acta Crystallographica Section F: Structural , 2010 - scripts.iucr.org
     
    2. The crystal structure of the AF2331 protein from Archaeoglobus fulgidus DSM 4304 forms an unusual interdigitated dimer with a new type of _+ _ fold
    S Wang, O Kirillova, M Chruszcz, D Gront - Protein , 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch