.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oyr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of UPF0341 Protein (yhiQ) from Shigella flexneri in complex with S-Adenosyl Homocysteine, Northeast Structural Genomics Target SfR275. To be Published
    Site NESGC
    PDB Id 2oyr Target Id SfR275
    Molecular Characteristics
    Source Shigella flexneri
    Alias Ids TPS9129,3.40.1630.10, PF04445, 3.40.50.150 Molecular Weight 26917.66 Da.
    Residues 250 Isoelectric Point 6.60
    Sequence mkiclidetgagdgalsvlaarwglehdednlmalvltpehlelrkrdepklggifvdfvggamahrrk fgggrgeavakavgikgdylpdvvdataglgrdafvlasvgcrvrmlernpvvaallddglargyadae iggwlqerlqlihassltaltditprpqvvyldpmfphkqksalvkkemrvfqslvgpdldadgllepa rllatkrvvvkrpdyapplanvatpnavvtkghrfdiyagtpv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.23
    Matthews' coefficent 2.22 Rfactor 0.213
    Waters 266 Solvent Content 44.63

    Ligand Information
    Ligands SAH (S-ADENOSYL-L-HOMOCYSTEINE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2oyr
    1. YhiQ is RsmJ, the methyltransferase responsible for methylation of G1516 in 16S rRNA of E. coli
    GN Basturea, DR Dague, MP Deutscher - Journal of molecular , 2011 - Elsevier
     
    2. MarkUs: a server to navigate sequencestructurefunction space
    M Fischer, QC Zhang, F Dey, BY Chen - Nucleic Acids , 2011 - Oxford Univ Press
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch