.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oys

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Functional insights from structural genomics. J.Struct.Funct.Genom. 8 37-44 2007
    Site NESGC
    PDB Id 2oys Target Id SpR27
    Related PDB Ids 1sqs 
    Molecular Characteristics
    Source Streptococcus pneumoniae
    Alias Ids TPS9159,PF03358, 3.40.50.360, PF02525 Molecular Weight 27146.14 Da.
    Residues 234 Isoelectric Point 5.18
    Sequence mnkifiyagvrnhnsktleytkrlssiissrnnvdisfrtpfnseleisnsdseelfkkgidrqsnadd ggvikkellesdiiiisspvylqnvsvdtknfieriggwshlfrlagkfvvtldvaesngsdnvseylr difsymggqilhqvsitnslkdiaeaqlmeatykiedvlegkikykttdyqerayqtlklilenydseh fekmywekkrlfeansleewyyvenik
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.225
    Matthews' coefficent 2.15 Rfactor 0.208
    Waters 430 Solvent Content 42.90

    Ligand Information
    Ligands FMN (FLAVIN) x 2;EDO (1,2-ETHANEDIOL) x 1
    Metals

    Jmol

     
    Google Scholar output for 2oys
    1. Functional insights from structural genomics
    F Forouhar, A Kuzin, J Seetharaman, I Lee - Journal of structural and , 2007 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch