.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p0g

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Selenoprotein W-related protein from Vibrio cholerae. To be Published
    Site NESGC
    PDB Id 2p0g Target Id VcR75
    Molecular Characteristics
    Source Vibrio cholerae
    Alias Ids TPS9231,PF10262, 3.40.30.10 Molecular Weight 11426.35 Da.
    Residues 97 Isoelectric Point 5.57
    Sequence mnkaqieiyycrqcnwmlrsawlsqellhtfseeieyvalhpdtggrfeifcngvqiwerkqeggfpea kvlkqrvrdlidperdlghvdrpsstqs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.30 Rfree 0.244
    Matthews' coefficent 2.21 Rfactor 0.226
    Waters 106 Solvent Content 44.22

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2p0g
    1. Molecular replacement: the probabilistic approach of the program REMO09 and its applications
    R Caliandro, B Carrozzini, GL Cascarano - A: Foundations of , 2009 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch