.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p0y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Q88YI3_LACPL from Lactobacillus plantarum. To be Published
    Site NESGC
    PDB Id 2p0y Target Id LpR6
    Molecular Characteristics
    Source Lactobacillus plantarum
    Alias Ids TPS8957,3.40.50.10680, PF01933 Molecular Weight 36602.68 Da.
    Residues 333 Isoelectric Point 5.36
    Sequence mrkytfktqrpkivvigggtglpvvlnglrkqavditavvtvaddggssgiirnyvnvvppgdirnvmv alsswpdlykdifqyrfqgddqffaghaignliiaaltemksgvfdavqelsnmmqvdghvypaaneal tlhgkfsdgtelvgeaeitaahkslervwvtdkngkepqavqpvidaimaadqivlgpgslftsilpnl tignigravcesdaevvyicnimtqkgetdnfsdadhvrvlnrhlgqnfintvlvntekvpedymdfhk fnevskqvshdfrglreqncrvissnflklrdngafhdgdqvvaelmnlvghsdvfr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.00 Rfree 0.339
    Matthews' coefficent 2.71 Rfactor 0.274
    Waters Solvent Content 54.60

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2p0y
    1. Molecular insights into the biosynthesis of the F420 coenzyme
    F Forouhar, M Abashidze, H Xu, LL Grochowski - Journal of Biological , 2008 - ASBMB
     

    Protein Summary

    See the TOPSAN PF01933 groups page for details.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch