The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of VPA0735 from Vibrio parahaemolyticus. To be Published
    Site NESGC
    PDB Id 2p3y Target Id VpR109
    Molecular Characteristics
    Source Vibrio parahaemolyticus
    Alias Ids TPS9236,, PF06863,, 1.10.3360.10, PF06742, Molecular Weight 55119.17 Da.
    Residues 483 Isoelectric Point 7.68
    Sequence mkkrilavavtsmllsasvfaqetvvpsrvgdlkfesdfptqetmknmlnemdfqratqaylwgipass imewlnvsrndfkfeegqmgffntlkqkqgiitanfttpyvigtwnlektgpliinlpeakmagmmldv hqrvlsdlsllgpdkgkggkylivppgekykdlnpkgyyvirpktnvvyggirilepdvdrvvkqvvpn ittqpyadgklgrkipvaqvpeidwthipkdgleywktihqiiqenpveerdrfvmaqlkflgiekgkp fnpteeqkkilleaskvgramaqsndytkrftqpywkgtnwkdaisvsldqrsenydelderaawfyea itvsrgmkstipgfgqrylvtyqdsdgnwlsgehtyklhvpanvpasnfwsttvydennrlmiindags pdissrknlkvnsdgsidvyygpkpvkgyennwvqtnpgegwftyfrfygptekmfdkswtmgdielvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.234
    Matthews' coefficent 2.68 Rfactor 0.204
    Waters 690 Solvent Content 54.11

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch