.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p6y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of the protein Q9KM02_VIBCH from Vibrio cholerae at the resolution 1.63 A. To be Published
    Site NESGC
    PDB Id 2p6y Target Id VcR80
    Molecular Characteristics
    Source Vibrio cholerae
    Alias Ids TPS9233,PF03479, 3.30.1330.80 Molecular Weight 14435.86 Da.
    Residues 130 Isoelectric Point 6.61
    Sequence mihlialrltrgmdlkqqivqlvqqhrihagsiascvgclstlhirladsvstlqvsapfeilslsgtl tyqhchlhiavadaqgrvwgghllegnlinttaelmihhypqhhftrefdpntgyselvvs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.63 Rfree 0.223
    Matthews' coefficent 3.36 Rfactor 0.207
    Waters 146 Solvent Content 63.41

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 2p6y
    1. The Zinc proteome: a tale of stability and functionality
    SF Sousa, AB Lopes, PA Fernandes, MJ Ramos - Dalton Trans., 2009 - xlink.rsc.org
     
    2. Structure-based de novo prediction of zinc-binding sites in proteins of unknown function
    W Zhao, M Xu, Z Liang, B Ding, L Niu, H Liu - , 2011 - Oxford Univ Press
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch