.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pgx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of UPF0341 protein yhiQ from Escherichia coli. To be Published
    Site NESGC
    PDB Id 2pgx Target Id ER585
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8862,3.40.1630.10, PF04445, 3.40.50.150 Molecular Weight 26947.69 Da.
    Residues 250 Isoelectric Point 6.60
    Sequence mkiclidetgtgdgalsvlaarwglehdednlmalvltpehlelrkrdepklggifvdfvggamahrrk fgggrgeavakavgikgdylpdvvdataglgrdafvlasvgcrvrmlernpvvaallddglargyadae iggwlqerlqlihassltaltditprpqvvyldpmfphkqksalvkkemrvfqslvgpdldadgllepa rllatkrvvvkrpdyapplanvatpnavvtkghrfdiyagtpv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.243
    Matthews' coefficent 2.10 Rfactor 0.228
    Waters 179 Solvent Content 41.45

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2pgx
    1. YhiQ is RsmJ, the methyltransferase responsible for methylation of G1516 in 16S rRNA of E. coli
    GN Basturea, DR Dague, MP Deutscher - Journal of molecular , 2011 - Elsevier
     
    2. Computational analysis of protein structures: data visualization, vector quantization, and spectral clustering
    KJ Lynagh - 2010 - dirigibleflightcraft.com
     
    3. Mutual information and variants for protein domain-domain contact prediction
    M Gomes, R Hamer, G Reinert - BMC Research , 2012 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch