.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ph0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Q6D2T7_ERWCT protein from Erwinia carotovora. To be Published
    Site NESGC
    PDB Id 2ph0 Target Id EwR41
    Molecular Characteristics
    Source Erwinia carotovora
    Alias Ids TPS8885,PF06228, PF05171, 3.40.1570.10 Molecular Weight 18250.70 Da.
    Residues 166 Isoelectric Point 5.61
    Sequence mtmtlnellatnpdgtlediagkyntslfavvealptaqctlatgdrfdqvwdtiatwgevtlishtad ailefkselptgthrhgyfnlrgknglsghiratscqhiafierkfmgmdtasvvffnangaamfkifl grdshrqllsaqvdafralaselqpeqv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.243
    Matthews' coefficent 1.91 Rfactor 0.219
    Waters 224 Solvent Content 35.61

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ph0
    1. Structure and heme binding properties of Escherichia coli O157: H7 ChuX
    MDL Suits, J Lang, GP Pal, M Couture, Z Jia - Protein Science, 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch