.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ph5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the homospermidine synthase hss from Legionella pneumophila in complex with NAD. To be Published
    Site NESGC
    PDB Id 2ph5 Target Id LgR54
    Molecular Characteristics
    Source Legionella pneumophila
    Alias Ids TPS8948,PF03435, 3.30.360.30, 3.40.50.720 Molecular Weight 52924.69 Da.
    Residues 472 Isoelectric Point 5.76
    Sequence mdknhntkkilfknrfvilgfgcvgqalmplifekfdikpsqvtiiaaegtkvdvaqqygvsfklqqit pqnylevigstleendflidvsigisslaliilcnqkgalyinaatepwkeefvmekmalnrrtnyslr eevlrlkdktqktalithganpglvshfikeallniakdngltinrpknaaewanlamtlgikvihvae qdsqvtyppkspgefvntwsanglileglqpaeigwgtheahwphdayshsngpqcaiylsrpsagvmv rswtptlgafhgflithaetisltnfltlkngsellyrptvhyaynpcpdarlsifelksnewkpqnkn rlilneiidgcdelgvllmgnqrgaywygstlsiqearqiapynnatslqvvasmisgiiwaiehpdeg ivepeevdhqyiidiakpylgkvggyytdwtplknrgelypeevdlsdpwqffnirvn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.261
    Matthews' coefficent 2.77 Rfactor 0.202
    Waters 179 Solvent Content 55.59

    Ligand Information
    Ligands SO4 (SULFATE) x 1;NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2ph5
    1. PSI-2: structural genomics to cover protein domain family space
    BH Dessailly, R Nair, L Jaroszewski, JE Fajardo - Structure, 2009 - Elsevier
     
    2. Evolution and multifarious horizontal transfer of an alternative biosynthetic pathway for the alternative polyamine sym-homospermidine
    FL Shaw, KA Elliott, LN Kinch, C Fuell - Journal of Biological , 2010 - ASBMB
     
    3. Hidden Relationship between Conserved Residues and Locally Conserved Phosphate-Binding Structures in NAD (P)-Binding Proteins
    CY Wu, YH Hwa, YC Chen, C Lim - The Journal of Physical , 2012 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch