.
The Open Protein Structure Annotation Network
PDB Keyword
.

2phz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Iron-uptake system-binding protein FeuA from Bacillus subtilis. To be Published
    Site NESGC
    PDB Id 2phz Target Id SR580
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9111,PF01497, 3.40.50.1980 Molecular Weight 33155.13 Da.
    Residues 298 Isoelectric Point 6.49
    Sequence mgsknestaskasgtasekkkieyldktyevtvptdkiaitgsvesmedaklldvhpqgaisfsgkfpd mfkditdkaeptgekmepniekilemkpdvilastkfpektlqkistagttipvshissnwkenmmlla qltgkekkakkiiadyeqdlkeiktkindkakdskalvirirqgniyiypeqvyfnstlygdlglkapn evkaakaqelssleklsemnpdhifvqfsddenadkpdalkdleknpiwkslkavkedhvyvnsvdpla qggtawskvrflkaaaekltqn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.15 Rfree 0.234
    Matthews' coefficent 1.94 Rfactor 0.200
    Waters 146 Solvent Content 36.60

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2phz
    1. Characterization of a Bacillus subtilis transporter for petrobactin, an anthrax stealth siderophore
    AM Zawadzka, Y Kim, N Maltseva - Proceedings of the , 2009 - National Acad Sciences
     
    2. The Staphylococcus aureus siderophore receptor HtsA undergoes localized conformational changes to enclose staphyloferrin A in an arginine-rich binding pocket
    JC Grigg, JD Cooper, J Cheung, DE Heinrichs - Journal of Biological , 2010 - ASBMB
     
    3. Trapping open and closed forms of FitEA group III periplasmic binding protein
    R Shi, A Proteau, J Wagner, Q Cui - Proteins: Structure, , 2009 - Wiley Online Library
     
    4. Specificity of Staphyloferrin B recognition by the SirA receptor from Staphylococcus aureus
    JC Grigg, J Cheung, DE Heinrichs - Journal of Biological , 2010 - ASBMB
     
    5. An unique iron coordination in the iron-chelating molecule vibriobactin helps Vibrio cholera evade the mammalian siderocalin-mediated immune response
    N Li, C Zhang, B Li, X Liu, Y Huang, S Xu - Journal of Biological , 2012 - ASBMB
     
    6. Mutual information and variants for protein domain-domain contact prediction
    M Gomes, R Hamer, G Reinert - BMC Research , 2012 - biomedcentral.com
     
    7. Cell surface iron-complex binding and transport by Staphylococcus aureus
    JC Grigg - 2010 - circle.ubc.ca
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch