.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pig

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ydcK from Salmonella cholerae at 2.38 A resolution. To be Published
    Site NESGC
    PDB Id 2pig Target Id ScR6
    Related PDB Ids 2f9c 
    Molecular Characteristics
    Source Salmonella choleraesuis
    Alias Ids TPS9121,2.160.10.10, 3.90.550.10 Molecular Weight 35920.44 Da.
    Residues 326 Isoelectric Point 5.19
    Sequence mtkyrlsegpraftyqvdgekksvllrqviavtdfndvkagtsggwvdadnvlsqqgdcwiydenamaf agteitgnaritqpctlynnvrigdnvwidradisdgarisdnvtiqsssvreecaiygdarvlnqsei laiqglthehaqilqiydratvnhsrivhqvqlygnatithafiehraevfdfaliegdkdnnvwicdc akvygharviagteedaiptlryssqvaehaliegncvlkhhvlvgghaevrggpillddrvlieghac iqgeilierqveisgraaviafddntihlrgpkvingedritrtplvgsl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.38 Rfree 0.269
    Matthews' coefficent 2.90 Rfactor 0.2195
    Waters 135 Solvent Content 57.60

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 3

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch