The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Q88U62_LACPL from Lactobacillus plantarum. To be Published
    Site NESGC
    PDB Id 2pjq Target Id LpR71
    Molecular Characteristics
    Source Lactobacillus plantarum
    Alias Ids TPS8958,1.10.472.50, 1.10.3210.10, PF01966, BIG_264 Molecular Weight 24328.20 Da.
    Residues 218 Isoelectric Point 6.34
    Sequence mitetqltaiqtyalqklahdhsghgrdhlqrvnrlarrlakdeganlnltlaaawlhdviddklmanp akahqdlivqlnaqnvtaddqtaifaiidhmsfsksfngpqklslegqvvqdadrldaigaigiaraly ysghvgekiydpaiaprehmtreqyrhqpgtainhfyeklfklaalmntdtakalaahrtavmhefvdq fkaewtaddka
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.80 Rfree 0.307
    Matthews' coefficent 2.03 Rfactor 0.236
    Waters 12 Solvent Content 39.49

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch