.
The Open Protein Structure Annotation Network
PDB Keyword
.

2q00

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the P95883_SULSO protein from Sulfolobus solfataricus. To be Published
    Site NESGC
    PDB Id 2q00 Target Id SsR10
    Related PDB Ids 2jpu 
    Molecular Characteristics
    Source Sulfolobus solfataricus
    Alias Ids TPS9161,15265, PF05942, 1.20.1270.90, 1.20.120.330 Molecular Weight 13991.34 Da.
    Residues 121 Isoelectric Point 6.75
    Sequence msistsaevyyeeaeeflskgdlvqacekyykaaeeaikllviennlkeitnnvknkgrwksenlfkas kllrsnnteipilwksawtlhvegfhelslnekevkklkedvrklvifavns
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.265
    Matthews' coefficent 2.83 Rfactor 0.225
    Waters 29 Solvent Content 56.58

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2q00
    1. Structure of the adenylylation domain of E. coli glutamine synthetase adenylyl transferase: evidence for gene duplication and evolution of a new active site
    Y Xu, PD Carr, SG Vasudevan, DL Ollis - Journal of molecular biology, 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch