.
The Open Protein Structure Annotation Network
PDB Keyword
.

2q0z

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Q9P172/Sec63 from Homo sapiens. To be Published
    Site NESGC
    PDB Id 2q0z Target Id HR1979
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS8909,1.10.3380.10, PF02889, 2.60.40.150, BIG_799, 1.10.150.20 Molecular Weight 37244.51 Da.
    Residues 329 Isoelectric Point 5.08
    Sequence mdvaplnlgmiaayyyinyttielfsmslnaktkvrglieiisnaaeyenipirhhednllrqlaqkvp hklnnpkfndphvktnlllqahlsrmqlsaelqsdteeilskairliqacvdvlssngwlspalaamel aqmvtqamwskdsylkqlphftsehikrctdkgvesvfdimemedeernallqltdsqiadvarfcnry pnielsyevvdkdsirsggpvvvlvqlereeevtgpviaplfpqkreegwwvvigdaksnslisikrlt lqqkakvkldfvapatgahnytlyfmsdaymgcdqeykfsvdvkeaetdsdsd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.220
    Matthews' coefficent 2.45 Rfactor 0.196
    Waters 265 Solvent Content 49.70

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2q0z
    1. Structural evidence for consecutive Hel308-like modules in the spliceosomal ATPase Brr2
    L Zhang, T Xu, C Maeder, LO Bud, J Shanks - Nature structural & , 2009 - nature.com
     
    2. Secondary and tertiary structure modeling reveals effects of novel mutations in polycystic liver disease genes PRKCSH and SEC63
    E Waanders, H Venselaar, RHM Te Morsche - Clinical , 2010 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch